SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10003335m|PACid:20910347 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10003335m|PACid:20910347
Domain Number 1 Region: 459-626
Classification Level Classification E-value
Superfamily BRCA2 helical domain 6.41e-56
Family BRCA2 helical domain 0.00042
Further Details:      
 
Domain Number 2 Region: 627-755
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.71e-38
Family Single strand DNA-binding domain, SSB 0.00016
Further Details:      
 
Domain Number 3 Region: 757-786,905-990
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-25
Family Single strand DNA-binding domain, SSB 0.0092
Further Details:      
 
Domain Number 4 Region: 787-905
Classification Level Classification E-value
Superfamily BRCA2 tower domain 6.47e-16
Family BRCA2 tower domain 0.0036
Further Details:      
 
Domain Number 5 Region: 995-1143
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000143
Family Single strand DNA-binding domain, SSB 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10003335m|PACid:20910347
Sequence length 1154
Sequence
MSTWQLFSDSSGDGFRWEVAGRILQSDSESTPTKALESTAPLSSMADLLLQGGSKLIERE
ESMPAEIPMFRTGLGKSVSLKESSIARAKSILADDKVAFPDLQNTKSSNPQMRQVDTAGT
FPMFTTALGRSVPLKESSIAKALSMLGGDKLIDSANVLPRESGFGVPNSFFQTASNKKVN
VSSAGLARAKALLGLEEDDLNEFMHVSQSSSSHQQHGSSGLKTNEEFDALAAQHHSRTPG
KFGDHVSGKRSEILNPSLKASTKFQTADGKSLSVSAEALTRARNLLGDPELGTFFDNVEA
GDQFVTPQKDGKLGDIIINNGSANTVYTAHEEKTSNKHTSNSFVSPLRSSSKQFRSVKLE
NLALGGNLIKKFDAAVDETDCTLKITGLATHGLSDNRPSSSDMAVNNFKENGLNPRAKQF
GRPVDQPLADITNRSDIAYANNKQDSTQKKRLGKTVSASPFKRPRISSFKTPLKKNDLHA
SSGLSVVSSNTLNSKKVLSTRYPERSPRVYIKDYFGMHPTATTKMDYVPDHVRRIKSSNA
DKYVFPDESSSNMVGAETFLQLLAQSGASTQHASRKWVTNHYRWIVWKLACYEIYYPAKC
RGNFLTVTNVLEELKYRYEREVNHGHYSAIKRILSGDAPASSMMVLCISAINPNTNNDSQ
NTHGSDSCSNVKVELTDGWYSMNAALDVVLTKQLNAGKLFVGQKLRILGAGLSGWATPTS
PLEAVTSSTICLLLNINGTYRAHWADRLGFCKEVGVPLAFNCIKCNGGPVPKTLAGITRI
YPILYKERLGEKKSIVRSERTESRIIQLHHQRRSALVEGLVCEYQRGINGVHSQNDTDSE
EGAKVFNLLETAAEPELLMAEMSPEQLTSYTTYKAKYEAAKQMKMEKSVAKALEDAGLGE
RNVTPFMRIRLVGLTSLSYEGEHNPKEGIVTIWNPTERQRTELTEGKIYIMKGLVPMNSG
SETLYLHARGSSSRWQPLSPKASESFQPFFNPRKPMSLSNLGEIPLSSEFDIAAYVVYVG
DAYTDVQQKKQWVFVTDGSTEHSGEISHKLLAISFSNPMDDISVPHISHNLVGSVVGFCN
LIKRAKDAKNEMWVGEATENSVYFINAEAAYSSHLKSSSAHIQTWAKRSSSNSVIHELRR
RVLFIIGACNSPSC
Download sequence
Identical sequences R0H4P4
Carubv10003335m|PACid:20910347 XP_006286782.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]