SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10007553m|PACid:20893672 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10007553m|PACid:20893672
Domain Number 1 Region: 8-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-22
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 130-210
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-18
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 3 Region: 249-331
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000275
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10007553m|PACid:20893672
Sequence length 347
Sequence
MADPVLQSPENPHFFKVLLPGFDSNLNIPMKFFSAYIEGRYEGKTVELESDASEKSWKVE
MEGRRLTFGWKEFASSHDLRIGDVIIFRHQGALLFHVACFGPSCCEIQYRQSCNDDDHLY
DDQENLSKLSSVHGIHILFFPKKFATSGALIKGSNNIVLMNEVAKKWRLILKFRESSRTF
YMRDGWRSFCHENGLKPGDAVTFELESNNLKTPLLRFSTAEFTSVSTKDCNKLGKINKSG
DSQKVSSSSSVTHLPKNFVKVNRMENLARRKITLLDKHGKDWAVTLVRERRNTQTRLGFG
LKDFFKANGTKANESLVFELVWEDKTTLPLLRFCSNAKTYSKLRPSY
Download sequence
Identical sequences R0H2N7
Carubv10007553m|PACid:20893672 XP_006286022.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]