SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10007829m|PACid:20896035 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Carubv10007829m|PACid:20896035
Domain Number - Region: 132-159
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00157
Family Rho termination factor, N-terminal domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10007829m|PACid:20896035
Sequence length 162
Sequence
QIADTPSPRFVLQNSCFEQSLSRIMLQDKASSLSLMGRAKKGYVCCKKQSNRGTSNPSKS
NQEEIISLLKRIQSSISKGESRGIEEKNSDESSGSKPLTKAILDVLEKSRKKTEGDTNVK
QEPPKRHSASGPRELKEVAKNRGIKGYSKLRKSELLELIRSS
Download sequence
Identical sequences R0H397
Carubv10007829m|PACid:20896035 XP_006286252.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]