SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10011823m|PACid:20893050 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10011823m|PACid:20893050
Domain Number 1 Region: 811-1037,1158-1205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.89e-72
Family Tandem AAA-ATPase domain 0.000000272
Further Details:      
 
Domain Number 2 Region: 516-803
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.47e-42
Family WD40-repeat 0.00099
Further Details:      
 
Domain Number 3 Region: 1209-1315,1411-1494
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.24e-41
Family Tandem AAA-ATPase domain 0.0000373
Further Details:      
 
Domain Number 4 Region: 1516-1650,1714-1795
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 3.66e-40
Family Helical scaffold and wing domains of SecA 0.0011
Further Details:      
 
Domain Number 5 Region: 1036-1157
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 2.35e-36
Family Pre-protein crosslinking domain of SecA 0.0000619
Further Details:      
 
Domain Number 6 Region: 5-61
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000501
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Weak hits

Sequence:  Carubv10011823m|PACid:20893050
Domain Number - Region: 239-270,307-435
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00167
Family Protein kinases, catalytic subunit 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10011823m|PACid:20893050
Sequence length 1799
Sequence
MEAPECPVCLQSYDGECSVPRVLACGHTACEECLTNLPKKFPDTIRCPACTVLVKFPLQG
PSALPKNIDLLRLFPSVSQIKLESGRNFKKPVEFVTRSWSDDFYATWKDRILVHDAVSVE
NGEGEISDLASSSRLFGSLKNDSKVSLLRVASFELDDCDSVLKYSYVQRMMSCLWGLKDE
ERDELEKIISIMQRGVSKVFGLWGDLKNGVLYLVGEKLIEFPWEEFDSLTDDDASRLGIV
GMQICEALLNLHKEGVISGCLSVSCVKFDEFENAYVDLIELMETGRNVCRIIAEETKSLR
KPVDASEMDSLLVGLLQKGIFMSSEFLFELLKEQNMLVKNDSSKSLVSYSADVWPVCFLL
LKLRLGNRFTKELIESVDAKGREESIEDLLVLYTGITEKLCLESELQGKFKLMVEILRQC
CCIDPQARPVLTDLWKCNRDLVMNPRFNSMRGLHKKIPGKRKEFCLALSELCHLVEVESK
ELEEASPGMKTGGKAEEGKVDIDFLGRLSEGKVKSKDIRGHQDSVTALAVGGGFLFSSSY
DKTILIWSLKDFSHVHTFKGHQDKVMAVIHIEGAKPVCISGDGGGGIFVWSTTVPMEDQP
LRKWYEPKDWRYTGIHALAYSEYGHVYSGSGDNTIKAWSLQDGSLVCTMSGHKSVVSTLV
VLNGVLYSGSWDGTVRLWSLSDHSLLTVLGEETPGIVRSILSLAADDQTLVAAYQNGDIQ
IWRDDTLMKSTKIQIGAILSIVVNGKWLFTGGWDKTINVQELSGDEISLDCTHVGSIPCA
SVITSLSYCEGKLFAGFADKTIKGNLGRMKRNIQDFTSMNYWVVRDYYRLVQSVNSLEPQ
IQSLSDEQLKAKTAEFRERLMRGDSLADMQAEAFAVVREAAKRTIGMRHFDVQIIGGGVL
HDGSIAEMKTGEGKTLVSTLAAYLNALTGEGVHVVTVNDYLAQRDAEWMGRVHRFLGLSV
GLIQRGMKAEERKFNYSCDITYTNNSELGFDYLRDNLTSNREQLVMRWPKPFHFAIVDEV
DSVLIDEGRNPLLISGEANENAARYPVAAKVAELLVKDIHYKAELKENSVELTEEGISLA
EMALETADLWDENDPWARFVMNALKAKEFYKRDVQYIVRDGKALIINELTGRVEDKRRWS
EGIHQAVEAKEGLEIQADSIVVAQITYQSLFKLYPKLSGMTGTAKTEEKEFLKMFQIPVI
EVPTNLSNIRIDLPIQAFATARGKWEHVRREVEDMFGQGRPVLVGTTSVENSEYLSELLK
EWGIPHNVLNARPKYAAREADFIAQAGRKYAITISTNMAGRGTDIILGGNPKMLAREIIE
DSILSYLTTEILADNLDDNELSQKVLSKIKVGPSSLALLARAALMAKYVGKSESKSWTRK
QAKSVITESLEKSQTMDPVKLQNLVNEQSEMYPLGPAIALAYLSVLKDCEAHCLHEGSEV
KRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRFMVSLQDEMFQKFNFDTEWAVRL
ISKITNDEDLPIEGDTIVKQLLALQINAEKYFFGIRKSLVEFDEVLEVQRKHVYDLRQLL
LTGENESCSQHIFQYMQAVVDEIVVGNSNPQKHPRYWSLAKLLKEFMAITGSLLDDSFSG
VTEVTMLQSLENLHETSSIDMEDFYLPHLPKPPNVFRGIRRKNSSLRRWLDICSDDLTGS
GRYRTSINLLRKFLGDYLIASYLTVVQESGFDDGYIKEIERAVLLKTLDCYWRDHLVNMN
KLSSAVNVRSFAHRNPLEEYKIDGCRFFISMLSATRRLTIESILQYWSSPMDSQELFIS
Download sequence
Identical sequences R0GTH5
Carubv10011823m|PACid:20893050 XP_006306193.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]