SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10015881m|PACid:20899436 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10015881m|PACid:20899436
Domain Number 1 Region: 96-213
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 2.09e-18
Family N-utilization substance G protein NusG, N-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 273-323
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000491
Family N-utilization substance G protein NusG, C-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10015881m|PACid:20899436
Sequence length 329
Sequence
MMKLEGGLLQWSRSSLIPSIYTTINKTHFSISACVIERNHQLTAKERRQLRNERRESKSG
YSWREEVEEKLIKKPKKRYATWTEELNLDTLAESGPQWWVVRVSRLRGHETAQILARALA
RQFPEMEFTVYAPSVQVKRKLKNGSISVKPKPVFPGCIFIRCILNKEIHDSIREVDGVGG
FIGSKVGNTKRQINKPRPVDDSDLEAIFKQAKEEQEKADSEFEEAERAEQEATLLASQNS
NSDVIEAVAESKPKRAPRKATLATETKGKKKKLVAGSTVRVLSGTFAEFVGNFKKLNRKT
AKATVGFSLFGKETLVEIDINELVLEIQS
Download sequence
Identical sequences R0I7Y1
XP_006299690.1.15642 Carubv10015881m|PACid:20899436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]