SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10019272m|PACid:20886858 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10019272m|PACid:20886858
Domain Number 1 Region: 24-106
Classification Level Classification E-value
Superfamily TSP9-like 1.12e-20
Family TSP9-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10019272m|PACid:20886858
Sequence length 106
Sequence
MVSSLLMSFAPATVRVYATGAKGASGAAKEEKNPLDFVLGFMTKQDQFYETDPILKKVEE
KEAARSSGTTGGRGTVRGGKSSAPTPVAPKKNEGGFGGLGGFFSKK
Download sequence
Identical sequences R0HPM0
Carubv10019272m|PACid:20886858 XP_006292995.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]