SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10023186m|PACid:20903581 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10023186m|PACid:20903581
Domain Number 1 Region: 411-449
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00000824
Family Rho termination factor, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10023186m|PACid:20903581
Sequence length 454
Sequence
MDDDDDLWGPPFVVKDDTCRKQTLRGCEFWFDCRTDVLEEHFQNERYCEKVWRILNEKKQ
DVVIVELDKDAISLQNDTASSGSGDSHAIGSSDSDKTLSATLPVVVTSSSKSLLDDDDEN
TSSISDAQTFETRDSSNDTQEIEPETRLKPQETAANDPLTVEVAEDADTSSSPALANKIE
EAEEHSCSSLVTDFDPIKQAPENKSSSAISRENIGGSTLKPFPLETSEKVGEKANASNED
GEVFKDHQKSDSLQVMVTVSQPFTTESLLEMCDEPDKGRELPYDARNKKSHPGPKKTVVK
DELIINLLTEARKKAESNALLNPGSVLIKKRQRQSNSSNNKGLNTSSIRNIKQKVQGGAR
KIIIDPVKKLDQSAPGIIRKSSVPTPQADSLVDSIDVRNQRDGRDSVISLSASELKNKTG
KELRSIAKELKVTHYYKLKKEDLLQRLTNRLNPS
Download sequence
Identical sequences R0HCC5
XP_006294191.1.15642 Carubv10023186m|PACid:20903581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]