SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10024162m|PACid:20902892 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10024162m|PACid:20902892
Domain Number 1 Region: 84-170
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.86e-16
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10024162m|PACid:20902892
Sequence length 176
Sequence
MGRGRSSSSSSIESSSKSNPFGGSSSTRNLSTDLRLGLSFGTGTSSGTQYFNGGYGYSVA
APAAEEAVYAAAVEEEEENECNSVGSFYVKVNMEGVPIGRKIDLISLNGYHDLIRTLDFM
FNASILWAEAEEVCNEKSHVLTYADKEGDWMMVGDVPWEMFLSTVRRLKISRAYHY
Download sequence
Identical sequences R0HEH7
Carubv10024162m|PACid:20902892 XP_006295081.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]