SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10000062m|PACid:20907681 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10000062m|PACid:20907681
Domain Number 1 Region: 195-425
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000801
Family Tropomyosin 0.0016
Further Details:      
 
Domain Number 2 Region: 373-631
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000288
Family Tropomyosin 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10000062m|PACid:20907681
Sequence length 1214
Sequence
MEIAAKSNSKRMYSWWWDSHNTPKNSKWLQDNLADMDNNVKQMIKVLEEDADSFARRAEM
YYRKRPELMKLVEEFYRAYRALAERYNHATGVLHKAHKTIAEVLHNEVPLIFGDESNDVD
PQTPEMLPLIRARVNPDGLQKDDSWFSLSHVHDVKRNIDFSDEAPFVSSGKARKGLNFND
VDGKGRNGLKAQIPSESERASKAEAEVVALKDSLSKMQAEKEASLAQFEKNLERLSNLES
EVSRAQEDSRGLSDRAASSEAEIQTLKETLYKLESEKESSRIRYEKCLQKIADLEDGLSV
AHKEAGGINERAIKAEAETLALKQSLAKAETDKEAALGQYRQCLNKISHLEERLRKAEED
TRLINVRAEKAGVEVENLKETISEMIKDKEASELQFQQCLNIIADLKVKLHHAQEETQSL
SHEIEDGVAKLKFSEEKCIVLERSNQNLHSELDGLLEKLGNQSEKLTEKQTELVKLWSCV
QEEHLRFQEAETAFRTLQQLHSQSQEELNNLAVELQTRSQIMKDMEIRNSELHEVIEQAK
VEKKGLSELNLSSVASIKSLQEDVSSLKEIIRKLEAEVELRVDQRNALQQEIYCLKEELS
QVGKKNQSMVEHVELVGSSVKELQEETSNLKECNERVLSEKRALSDKLETMEKLVKKNLM
LEKSISDLNFELESIRRKLKTVEEACQSLSDVKSCLIIENQHTVIENIVLIEWLQQLKLE
AVGIETEKKNLEGKANKIGGKLIDAETENMQLKRSLLSIRSDKDHLEDEIVNVKAQLHKK
EKELEEMKGENEKLNQEVFKERSKAELWESQAVTFFCDKQISAVHETLIEATTRELAEAC
KNLESKSASKDTDIEKLKRSQAIVLLNESVNSLENYVFVRRESEHEILKGADSMDEFPKL
EDMCLRIKAIAEAIMEKEKLLILENTNAYSMLEASLKEIKELKTGSGRSMRKQEGGNGKM
RKQSHEIEMVMKDIVLDQTSDGSSYEIVSKKGALELDHHGFVELKPVKTHKTETAAKTGK
GKSLSEESLIVDKVEIFDGFMDPSREINKRKIVERLDSDLQKLENLQITVEDLKNKVNTV
GKEKIKVGENEYETIKGQLEEADEAIEKLFNVNRKLTTKAESEKDIDRRKRISEQARRGS
EKIGRLQLEIHRIQFLLTKLEGERENRARSKISDTKSKVLLRDYIYGGSRSVPMKKKTKK
RAAFCGCVQQPLSP
Download sequence
Identical sequences R0FD89
XP_006286918.1.15642 Carubv10000062m|PACid:20907681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]