SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10000065m|PACid:20907860 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10000065m|PACid:20907860
Domain Number 1 Region: 117-224
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-38
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 1090-1155
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000108
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10000065m|PACid:20907860
Sequence length 1204
Sequence
MKAPSSNGVSPNPVEGERRNINSELWHACAGPLISLPPAGSLVVYFPQGHSEQVAASMQK
QTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGLKLN
RQPNEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQPPCQELVAKDIHDNTWTFR
HIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRYINLNVPMLFRYLFVKMLTSFHFQL
RDGKAQLLLGIRRANRQQPALSSSVISSDSMHIGVLAAAAHANANNSPFTIFYNPRAAPA
EFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNL
QIGWDESAAGDRPSRVSVWDIEPVLTPFYICPPPFFRPRFGGQPGMPDDDTDMESALKRA
MPWLDNSSEMKDASSTIFPGLSLVQWMNMQQQQQNGQLPSAAAQPGFFPSMLSPTTALHN
NLGGTDDPSKLLSFQMPQGGVSSSNLQFNKPNVQSPMSQLPQPSTTLSQQQQLQQLLHSS
LNQQQQQSQSQQQQQQQLLQQQQQLQSQQHSNNNQSQSQQQQQQQQQQHLQQQQQQQQQQ
LLQQQHQQPLQQQTQQQQQRTQSLQSHSRSQPQPQPQPQPQPHKLQQLQLPQNQLYNGQQ
AAQQLQAQQHLQPQLVSGSMASSAITPPSSSHNQSFQQQQQSKKLQQAHHHLGASTCQSS
VIETSKSSSNLMSVPPQETQFQRQVEQQQPPGLSGQNQQTLLQQKAHQAQAQQIFQQSLL
EQPHLQFQLLQRLQQQQQQQQQQQFLSPQSQLPHHQLQSQQLQQLPALSQGHQFPSSCIN
NGLSTLQPPQMLVSRPQEKQHPPVGGGVKAYSGITDGGDAPSSSTSPSTNNCQISSSGFL
NRTQSGPAILIPDAAIDMSSNLVQDLYSKSDMRLKQELVGQQKSKASLTDHHLEASASGT
SYGLDGGDNNRQQNFLAPTFGLDGDSRNSLLGGANVDNGFVPDTLLSRGYDSQKDLQNML
SNYGGVTTDIGTEMSTSAVRTQSFGVPNVPAISNDLAVNDAGVLGGGLWPAQTQRMRTYT
KVQKRGSVGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHENDILLVG
DDPWEEFVNCVQSIKILSSAEVQQMSLDGNFAGVPVTNQACSGGDSGNAWRGHYDDNSAT
SFNR
Download sequence
Identical sequences R0GSG5
XP_006286921.1.15642 Carubv10000065m|PACid:20907860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]