SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10000142m|PACid:20911102 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10000142m|PACid:20911102
Domain Number 1 Region: 122-451
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.48e-81
Family G proteins 0.00000122
Further Details:      
 
Domain Number 2 Region: 672-840
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.33e-56
Family Translational machinery components 0.0000219
Further Details:      
 
Domain Number 3 Region: 453-582
Classification Level Classification E-value
Superfamily Translation proteins 2.43e-35
Family Elongation factors 0.00032
Further Details:      
 
Domain Number 4 Region: 841-928
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.78e-27
Family EF-G/eEF-2 domains III and V 0.00018
Further Details:      
 
Domain Number 5 Region: 598-670
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000000000104
Family EF-G/eEF-2 domains III and V 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10000142m|PACid:20911102
Sequence length 985
Sequence
MDDSLYDEFGNYIGPEIESDRESDDEVEEDEDNQPEENGHGSDGEQGGPNGWITTINDVE
MENQIVLPEDKKYYPTAEEVYGEDVETLVMDEDEQPLEQPIIKPVRDIRFEVGVKDQSTY
VSTQFLIGLMSNPTLVRNVALVGHLQHGKTVFMDMLVEQTHHMSTFNVKNEKHMKYTDTR
VDEQERNISIKAIPMSLVLEDSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDA
AEGVMVNTERAIRHAIQDRLPIVVVINKVDRLITELKLPPRDAYYKLRHTIEVINNHISV
ASTKAGDLPLIDPAAGNVCFASGTAGWSFTLQSFAKMYAKLHGVAMDVDKFASRLWGDVY
YHPDTRVFKRTPPVGGGERAFVQFILEPLYKIYSQVIGEHKKSVETTLAELGVTLSNSAY
KLNVRPLLRLACSSVFGSASGFTDMLVKHIPSPREAAARKVGHAYTGPKDSPIYESMVEC
DPSGPLMVNVTKLYPKSDTSVFDVFGRVYSGRLQTGQSIRVLGEGYSPEDEEDMTIKEVT
KLWIYQARYRIPVSSAPPGSWVLIEGVDASIMKTATLCNASYDEDVYIFRALQFNTLSVV
KTATEPLNPSELPKMVEGLRKISKSYPLAITKVEESGEHTILGTGELYLDSIMKDLRELY
SEVEVKVADPVVSFCETVVESSSMKCFAETPNKKNKITMIAEPLDKGLAEDIENGVVSID
WNRKQLGDFFRTKYDWDLLAARSIWAFGPDKQGPNILLDDTLPTEVDRNLMMAVKDSIVQ
GFQWGAREGPLCDEPIRNVKFKIVDARIAPEPLHRGSGQMIPTARRVAYSAFLMATPRLM
EPVYYVEIQTPIDCVTAIYTVLSRRRGHVTSDVPQPGTPAYIVKAFLPVIESFGFETDLR
YHTQGQAFCVSVFDHWAIVPGDPLDKSILLRPLEPAPIQHLAREFMVKTRRRKGMSEDVS
GNKFFDEAMMVELAQQTGDLHLQMM
Download sequence
Identical sequences R0H587
Carubv10000141m|PACid:20911101 Carubv10000142m|PACid:20911102 XP_006286996.1.15642 XP_006286997.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]