SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10001689m|PACid:20908400 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10001689m|PACid:20908400
Domain Number 1 Region: 43-152
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.23e-31
Family B3 DNA binding domain 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10001689m|PACid:20908400
Sequence length 274
Sequence
MSVNHYSTDHHHTLLWQQQHHTTDASETATTTAAWLNDDLKESLFEKSLTPSDVGKLNRL
VIPKQHAEKYFPLNAVADNSSSSEKGMLLSFEDETGKSWRFRYSYWNSSQSYVLTKGWSR
FVKDKQLDPGDVVFFQRHRSDLRRLFIGWRRRGQGSSSAVNTSSMAAPSYRQIHHSSTNY
SNPPSHSEYSHYGAAVATAGETHSTPSSSVVAGSSRTLRLFGVNLECQMDDNDGDDSAAA
AAAAVESPDGYYGQNMYYYYPHPHNMNIAFTGER
Download sequence
Identical sequences R0GWN8
Carubv10001689m|PACid:20908400 XP_006288431.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]