SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10001768m|PACid:20908401 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10001768m|PACid:20908401
Domain Number 1 Region: 43-152
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.45e-31
Family B3 DNA binding domain 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10001768m|PACid:20908401
Sequence length 257
Sequence
MSVNHYSTDHHHTLLWQQQHHTTDASETATTTAAWLNDDLKESLFEKSLTPSDVGKLNRL
VIPKQHAEKYFPLNAVADNSSSSEKGMLLSFEDETGKSWRFRYSYWNSSQSYVLTKGWSR
FVKDKQLDPGDVVFFQRHRSDLRRLFIGWRRRGQGSSSAVNTSSMAAPSYRQIHHSSTNY
SNPPSHSEYSHYGAAVATAGETHSTPSSSVVAGSSRTLRLFGVNLECQMDDNDGDDSAAA
AAAAVESPDGYYGQNII
Download sequence
Identical sequences R0HCB8
Carubv10001768m|PACid:20908401 XP_006288430.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]