SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10002417m|PACid:20910712 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10002417m|PACid:20910712
Domain Number 1 Region: 16-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-20
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 215-306
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-20
Family B3 DNA binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10002417m|PACid:20910712
Sequence length 308
Sequence
MVSNRAFGQLMEEGYNPAFFKILRREDSSSEIMRMIPHHLIRSISDKSSSFKMVLKVPWG
NSWSVKISKNPVFYYMEDRGWNQFVNDNGLGENEYLTFTHEANMCFNVSIFEANGTEMLR
PRKSSPVASSSGGNKREERRSIYIDVKKEEGTESCSESRYPDLKTAESTSGRSKQKQKFN
LRQKEAEETKKSKKSKNRKVNTVCNDFEAGTSSLVPEFKLTIKKSHLLFLGIPKKFVDMH
MPNEAKMFKIRHPRGKKSWEVSYVVTDVQSRFSAGWSRLAKELGLEVGDVCTFKLIKPTE
MHVKVSKE
Download sequence
Identical sequences R0FIQ9
XP_006289033.1.15642 Carubv10002417m|PACid:20910712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]