SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10004139m|PACid:20894890 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10004139m|PACid:20894890
Domain Number 1 Region: 112-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.05e-47
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 712-792
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000026
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10004139m|PACid:20894890
Sequence length 824
Sequence
MKLSTSGLGQQGHEGEKCLNSELWHACAGPLVSLPSSGSRVVYFPQGHSEQVAATTNKEV
DGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPEEQKETFVPIELGIPSK
QPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTLQPPAQELIARDLHDVEWKFRH
IFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIRNEKNQLFLGIRRATRPQTIVPSSVLS
SDSMHIGLLAAAAHASATNSCFTVFFHPRASPSEFVIQLSKYIKAVFHTRISVGMRFRML
FETEESSVRRYMGTITGISDLDTVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT
FPMYPSLFPLRLKRPWHAGTSSLPDGRGELGSGLTWLRGGGGDQQGLLPLNYPSVGLFPW
MQQRLDLTQMGTDNNQQYQAMLAAGLQNIGGGDPLRQQFVQLQEPHHQYVQQSASHNSDL
MLQQQQQQQQQQASRHAMHAQTQVMSENIPQQNMRQEVSNHPTGQQLQQPDQNAYLNAFK
MQNGHLQQWQHQEMASPSFMKSDFTDSSNKFATSATPMQQNAASPASNDGSNLLNFSITG
QSVLPEQLTTEGWSPKASNTFSEPLSLPQAYPGKSLALEPGNPNLNPQNPSLFGVDPDSG
LFLPSTVPRFASSSGDAEASPMSLTDSGFQNSLYGCMQDTTHELLHGAGQINPSNQTKNF
VKVYKSGSVGRSLDISRFSSYHELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLL
GDDPWESFVNNVWYIKILSPEDVQQMGDQGEGSAGSFPQNPTHL
Download sequence
Identical sequences R0GF16
XP_006282446.1.15642 Carubv10004139m|PACid:20894890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]