SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10004142m|PACid:20894021 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10004142m|PACid:20894021
Domain Number 1 Region: 451-471,525-564,596-780
Classification Level Classification E-value
Superfamily HAD-like 9.62e-37
Family Meta-cation ATPase, catalytic domain P 0.0025
Further Details:      
 
Domain Number 2 Region: 259-346
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000000000000471
Family Calcium ATPase, transduction domain A 0.011
Further Details:      
 
Domain Number 3 Region: 189-241,348-447
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000824
Family Calcium ATPase, transmembrane domain M 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10004142m|PACid:20894021
Sequence length 822
Sequence
MEPAALTRSSSLTRFPYRCGIATLRLARVNSFSILPPKTLLRREPLPLRISASLSLPPRS
IRLRAVEDHHHDHHHDDEQDHHHHHHHHHQHGCCSVELKAESKPQKVLFGFAKAIGWVRL
ANFLREHLHLCCSSAAMFLAAAACPYLVPKPYIKSLQNAFMIVGFPLVGVSASLDALMDI
AGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAEEFFTSRSMVDVKELKESNP
DSALLIEVINGNVPNISDLSYKSVPVHSVEVGSYILVGTGEIVPVDCEVYQGSATITIEH
LTGEVKPLEAKAGDRVPGGARNLDGRMIVKATKAWNDSTLNKIVQLTEEAHSNKPKLQRW
LDEFGENYSKVVVVLSLAIAFLGPFLFKWPFLSTAVCRGSVYRALGLMVAASPCALAVAP
LAYATAISSCARKGILLKGAQVLDALASCHTVAFDKTGTLTTGGLTCKAIEPIYGHQGRN
NSSVTTCCVPTCEKEALAVAAAMEKGTTHPIGRAVVNHSVGQDLPSVLVESFEYFPGRGL
TATVNGVKSLAEESRLRTASLGSIEFITSLFKSEDESKQIKDAVNASLYGKDFVHAALSV
DQKVTLIHLEDQPRPGVSGVIAELKSWARLRVMMLTGDHDSSAWRVANAVGITEVYCNLK
PEDKLNHVKNIAREAGGGLIMVGEGINDAPALAAATVGIVLAQRASATAIAVADILLLRD
NITGVPFCVAKSRQTTSLQNVALALTSIFLAALPSVLGFVPLWLTVLLHEGGTLLVCLNS
VRGLNDPSWSWKQDISHLIKKLSSRDLISSSSNSLSSAEPSH
Download sequence
Identical sequences R0GY42
XP_006283120.1.15642 Carubv10004142m|PACid:20894021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]