SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10004182m|PACid:20894103 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10004182m|PACid:20894103
Domain Number 1 Region: 355-553
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000209
Family Tropomyosin 0.0042
Further Details:      
 
Domain Number 2 Region: 171-346
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000036
Family Tropomyosin 0.0016
Further Details:      
 
Weak hits

Sequence:  Carubv10004182m|PACid:20894103
Domain Number - Region: 540-751
Classification Level Classification E-value
Superfamily Tropomyosin 0.00196
Family Tropomyosin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10004182m|PACid:20894103
Sequence length 784
Sequence
MKKHRLREALQSFFEPHFDHEKGEMLKRTKTEIDEKVTKILGIVESGDIVEDESKRQVVA
ELVNEFYNEYQSLYRQYDDLTGEIRNKVNGKGETSSSSSSDSDSDHSSKRKTKRNGKGKV
ESVTGALKQQIETVNLEIADPKGKLTTTIEEKEAADSELEVALMKLKESEEIINKLKLET
EKLEDAKTTALSYNRELHQKLDDAGKTENDLKQKLEDVKRERDELKTERDNGNKRFQEAE
KVAEDREATSDQLKDEASNFEQQLEASEQRVSELTSGMNSAEEVNKSSEQRVSDLSVSLK
DAEEENKAISSKNLETMEKLEQAQNTIKELREELGALKGQHKEKECELSSVVGVHEAYQR
DSTSRVEELVAVVQSADKKVADMKQSLDNTEKEKKLLSQRIPEISNEIQEAKKSTQELMS
ESEQLKESHGVKERELSCLRGIHETHQRESSTRLSELETQLKSSEQRAVDLSTSLHAAEK
ENKSISSKILETTDELKQAQSKVQELLTELAESKDTHIQKESELSSLVEVHEAHKRDSSS
QVKELEARVESAEKLVEELNQRLNSSEEEKKLLSQRISEMSTEIKRAESTIQELMSESEQ
LKRSYTEKDNELFSLRNIHENHQRESSTQLRDLEAQLKSSEQGVSELSESLKAAEEESKT
MSMKISKTSDELEQAQIMVKELTADSSKLKEQLAEKEGELLLLPEKDRKSQVQIKELEAT
AVTLERELESARSRIIDLEKDIGSKTTAVEQLEALNREMVANRDPLHSSENSLLGIKTQQ
ASVN
Download sequence
Identical sequences R0F3V9
XP_006283153.1.15642 Carubv10004182m|PACid:20894103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]