SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10004315m|PACid:20896005 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10004315m|PACid:20896005
Domain Number 1 Region: 63-271
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.92e-54
Family G proteins 0.00013
Further Details:      
 
Domain Number 2 Region: 467-561
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.76e-24
Family EF-G/eEF-2 domains III and V 0.014
Further Details:      
 
Domain Number 3 Region: 254-344
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000106
Family Elongation factors 0.0086
Further Details:      
 
Domain Number 4 Region: 359-436
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000000000281
Family EF-G/eEF-2 domains III and V 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10004315m|PACid:20896005
Sequence length 663
Sequence
MGSMYRASKTLKSSRRAFSVLSNSLKSNRRDPLCIGLYQAYGFSSDSRHSSKEPTIDLTQ
FPSEKIRNFSIIAHIDHGKSTLADRLMELTGTIKKGHGQPQYLDKLQVERERGITVKAQT
ATMFYENKVKDQEASGFLLNLIDTPGHVDFSYEVSRSLSACQGALLVVDAAQGVQAQTVA
NFYLAFESNLTIVPVINKIDQPTADPERVKAQLKSMFDLDTDDVLLVSAKTGLGLEHVLP
AVIERIPPPPGISDSPLRMLLFDSFFNEYKGVICYVSVVDGMLTKGDKVSFAASGQSYEV
LDVGIMHPELTSTGMLLTGQVGYIVTGMRTTKEARIGDTIYRTKTTVEPLPGFKPVRHMV
FSGVYPADGSDFEALSHAIEKLTCNDASVSVAKETSTALGMGFRCGFLGLLHMDVFHQRL
EQEYGTQVISTIPTVPYTFEYSDGTKLQVQNPAALPSTPKYRVTASWEPTVIATIILPSE
YVGAVINLCSDRRGQQLEYTFIDAQRVFLKYQLPLREIVVDFYDELKSITSGYASFDYED
AEYQASDLVKVDILLNGQAVDALATIVHKQKAYRVGKELVEKLKNYIDRQMFEVMIQAAI
GSKIIARDTISAMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDIPHEAFQQIL
KVS
Download sequence
Identical sequences R0F3C9
Carubv10004315m|PACid:20896005 XP_006283279.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]