SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10004343m|PACid:20895898 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10004343m|PACid:20895898
Domain Number 1 Region: 289-636
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.09e-92
Family IF2B-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10004343m|PACid:20895898
Sequence length 643
Sequence
MESRRNPRAVVDPKVRQVGFFTSSQPDSSSSQLQQPDPISASASSPPVSTISPSGNSLSP
VMIPPPRHNSSDAFPLRNAVVASAVSPSSFSYSSRRDFPDGSTTASPGRHSRGSFVKSSV
PVASSLPGIGMDSMAAAKSSSVPASGLTTVSVVTMPPGLSEKASGMEVESDHKKNSKPLK
EKTTKAERRAIQEAQRAAKAAAKVDGGKGPAVTSASVASTSAKAARPAKPTSQKNDVAVA
AGAAEKKGGPSEKDRKKDAPHPRMQYDDESRVVKAKRRAVVKQTEAKNRVELFRHLPQYE
HGTQLPDLETKFFQLDPMHPAVYKVGLQYLSGDISGGNARCIAMLHAFQEVVKDYSTPPE
KNLNRDMTAKISSYVSFLIECRPLSISMGNAIRFVKNRIAKLPITLSESEAKAALQSDIE
RFINDKIIGADTVIVKHAVSKIRDGDVLLTYGSPTAVEMVLLHAHELRKKFRVLVVDSRP
KLEGQLLLRRLIKRGINCTYTHINAISYIMHEVTKVFLGASSVLSNGTVYSRVGTACVAM
VASAFRVPVLVCCEAYKFHERVQLDSICSNELGDPNAISKVHGREDINYLDGLTNNANLQ
FLNLMYDATPSDYISMIITDYGMVPPTSVPVIVREYQKEHLLV
Download sequence
Identical sequences R0GV74
XP_006283307.1.15642 Carubv10004343m|PACid:20895898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]