SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10004462m|PACid:20895752 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10004462m|PACid:20895752
Domain Number 1 Region: 286-388
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.02e-19
Family B3 DNA binding domain 0.0086
Further Details:      
 
Domain Number 2 Region: 179-281
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.14e-17
Family B3 DNA binding domain 0.0066
Further Details:      
 
Domain Number 3 Region: 468-568
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-16
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 4 Region: 60-144
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000432
Family B3 DNA binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10004462m|PACid:20895752
Sequence length 574
Sequence
MAESVLQTPKNPHFFQPLLPGFDSYLVLCLCLSSTIIYSLAYSKRYGSVLETSYAFLLQN
IPVTFYLKHLQGRNEHKTAKLRTDASDTVWELKIEDGQRLTEGWKEFVTANDFRIGDVTV
FRHEGDLVFHVTALGLRGCEIEYTSSHSVDDDCDNHQENIETRPVKKNPGREEDSSLDHS
CFVANVSVSNLYEDKLYVPVGFARSSGLCKKTGKIVLLNELGRSWKLSLDHDKSGSKTYL
RHGWRSFCNANGMNRGGYTFKLVRNSGTPVIQVCRAGCRPDAESSSDCSFFSGFVTTSNL
DHDALYLPRVFVSSNGLDKGRCDEMVLKNEDGRTWNLVLRHDKSNNSVLISRGWRSFCQV
NGLKARDTFRFKLVITGGKHVLCLCSAETSRDTRVLECSEGTDVDSLSTDPSRAEESSET
EESEDNGRDNTIVKEDSEEESIEDKSSLRECSIAEKWKHSSRPGASSSSSQSRFVTLTFS
PYSFRSNKLRLPLCFTRANGIKKPGKITLLGRDGVNRMVRLLKDHENGRLRLGRDWKGFC
RVHGVKIGESFVLELIWKKDAGPVLKFCTKVNCV
Download sequence
Identical sequences R0F4H1
Carubv10004462m|PACid:20895752 XP_006283413.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]