SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10004653m|PACid:20893631 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10004653m|PACid:20893631
Domain Number 1 Region: 133-235
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-19
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 266-363
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000235
Family B3 DNA binding domain 0.018
Further Details:      
 
Domain Number 3 Region: 11-71
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000255
Family B3 DNA binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10004653m|PACid:20893631
Sequence length 496
Sequence
MTKHFKGKIQSTKLKLTSVASDRVWEVQLDGRRFAGGWKNFSVFHSVRGDDVLSFRHDGG
MAFHVTPFGRSFSQIQLISSSTSDDEHNVFDAHDDDKDDDVDLGDDDNPVSEEDLCLKKT
SSKKRARTETESSEETYLIAHVTPSSLKRDNMCLVSKFARSNGLGGRECYIDLKDEHGKS
WTLLLRHNKSTGQAFMRGGWKLFCRSNGIKAGSSCRFKLVQSGTKPVLQLCPNTSSSKAN
EKENVSESEVDEIESEHCSETVPMHQNKILTLDLKPYTLRTCQFRVPASLTRENGILEAG
EVTIVNKDGEEWKSYLVNVKGRDQFYIRGCKAFFVANGIKNVGDPFTLEVIRGGLSPILK
ICSKVKQASFDGHKTLERKPQMTVQAQHAEDETENRVQKKARVCTEEGPSRCTRGLNKPS
STDPENLQGKQPLQPCSISDHVKKVKQSIVETLTDVRRFRSELENKEQNLEASLQEIDAL
GEKMTGISKIFNISEV
Download sequence
Identical sequences R0GW33
XP_006283597.1.15642 Carubv10004653m|PACid:20893631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]