SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10004975m|PACid:20896719 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10004975m|PACid:20896719
Domain Number 1 Region: 8-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-21
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 161-249
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.12e-18
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 3 Region: 289-393
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000746
Family B3 DNA binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10004975m|PACid:20896719
Sequence length 398
Sequence
MVNSPLQSPKNPHFFQPLLPGFETHLTIPVVFFSEHIVGKHEEEKKARLRSDSSERTWEV
KMDGRRLTQGWNDFVKAHDLRIGDVIVFKHEGDMVFSVTPFGPSCCEIQYPQSHIKKEHY
NDDDDDDDKDDMENQHTTREGLRKRNLKPKTEPESFVSYDYSFVANVTASNLIFDTINLP
KKAASFVALNKGCHKIILVNEEGKSWTLNLRFRESEGSYYMRGGWTRFCRENRQKEGDMI
TFNLVGDGESIPLLCICPEEVCSELMSKAKEKKKLVKRRRWEVSPSPGRNSYVTISLTAY
NIKNSKITLPVEFTRVNGITNKHEKIILEDKHGVKRLTKLVRDGPDHRKRGLGKGWKLFC
SVNDVLKVGEPFTLKLLWENRTPLLKFCSKVKEEPIYV
Download sequence
Identical sequences R0F4T2
Carubv10004975m|PACid:20896719 XP_006283864.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]