SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10005377m|PACid:20893512 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10005377m|PACid:20893512
Domain Number 1 Region: 190-285
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-19
Family B3 DNA binding domain 0.008
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000235
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10005377m|PACid:20893512
Sequence length 295
Sequence
MFVKDHSLKENDLLVFKFHGLSEFEVLIFDGQTLCEKPTSYFVRKCGHADKTKCTDFTAT
SSRSPEILFNPVDVEATPNQQRLISPVDNELDDLIDIDVDIETMLTPHLVVSQTGCEQLE
HFNSDIDTAYAQIPVISPASTGRVSEEKYPLSGLKKMQGEINNDSLDHKAAGRKNKTLSL
AQRVITPDGFLVVMKRSHVSKCFLTIPYKWCKKNNLLARQEVVMQIDQMKWVMKFNLFGS
RCSGGISTGWKKFVQDNNLCESDVCVFEPMKSEKQPLHLYVYIFRVAEAESTNKG
Download sequence
Identical sequences R0H0Z0
XP_006284220.1.15642 Carubv10005377m|PACid:20893512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]