SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10006245m|PACid:20894220 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10006245m|PACid:20894220
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.61e-19
Family B3 DNA binding domain 0.00036
Further Details:      
 
Weak hits

Sequence:  Carubv10006245m|PACid:20894220
Domain Number - Region: 254-339
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000129
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10006245m|PACid:20894220
Sequence length 353
Sequence
VIPISYYDQLPRVLPKKVILQGPGGGSWNVATKIRGEEVHLAQGWSKFVEDNTLNDGDFL
TFIYNGDRIFEVSIYRSDGCKETCEVTEVEDEKVDSVCSLSSDDTDTCPKPEMNNTIPKG
RDKGKSKVQVVEDSDEHENSVYSESSDETKTDSDTDSEFKIAKKTTPKRMNKGKKKKEAV
EESFDEDGDGDSDSDYVEAFGQLDVEEKSDSEDSSYAPENEDTAATTCVKPKVPNLKRKV
EPKIKNPETYLDDPKNIHFETNVKNRLYELLVHAQLVKDYCLTFGDHVDYIDRFGKLRAK
TAKWKDQRVCIKRWMRICKRNELKKEDRILCELLRRGSFVYAIKLHVIRGENL
Download sequence
Identical sequences R0F894
XP_006284943.1.15642 Carubv10006245m|PACid:20894220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]