SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10006486m|PACid:20895379 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10006486m|PACid:20895379
Domain Number 1 Region: 268-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000195
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 44-187
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000589
Family BTB/POZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10006486m|PACid:20895379
Sequence length 585
Sequence
MAATAMEPSSSISFTSSHLSNPSPVVTNHHSPANLEAESLIKLSSNLEQLLTNPDCDYTD
AEIIIVDEAQPVSVHRCVLAARSKFFLDLFKKDKESSGKSEKKPKYQMKDLLPYGNVGRE
AFLHFLNYIYTGRFKSFPIEVSTCVDSVCAHDSCKPAIDFAVELMYASHVFQMPELVSSF
QRRLCNYVEKSLVENVIPILLVAFHCDLTQLLDQCIERVARSDLGRFCIEKELPSEVSEK
IKQLRVKSVNVPEVVDKSLERAGKVLKALDSDDLELMKLLLSESDITLDQANGLHYAVAY
SDPNVVIQVLDLNMADVNFRNSRGYTVLHIAAMRREPKIIISLIQKGANPSDFTFDGRSA
VNICRRLTKPKDYYTKNSKKEPSKDRLCIDLLEREIRRNPLVSGDTPTCSHSMPEDLQMR
LLYLEKRVGLAQLFFPAEADVAMQIANVEGTSECTGLVIPPPSNGTTGNLGQVDLNETPY
VQTKRMLTRMEALMKTVETGRRYFPSCSEVLDEYMEQYMDEDIPDMSHPEKGSVKERRQK
RMRYNELKNDVKKAYNKDKEAKIARSCLSDSSADSSLREALENPT
Download sequence
Identical sequences R0F8U1
XP_006285143.1.15642 Carubv10006486m|PACid:20895379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]