SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10006513m|PACid:20894871 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10006513m|PACid:20894871
Domain Number 1 Region: 117-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.62e-39
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 573-644
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000255
Family PB1 domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10006513m|PACid:20894871
Sequence length 683
Sequence
NDGVGQTILAEVSNETSECLYDELWKLCAGPLVDVPQAGERVYYFPQGHMEQLEASTRQD
LNTRKPLFDLPPKILCNVMNVRLQAEKDTDEVYAQITLIPVGTEVDEPMSPDTSPPETQK
PKVHSFSKVLTASDTSTHGGFSVLRKHATECLPPLDMTQQTPTQELVAEDVHGYQWKFKH
IFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFLRGENGELRVGVRRANRQQSSMPSSVIS
SHSMHLGVLATACHATQAKTMFIVYYKPRTSQFIISLNKYLEAMDNKFSVGMRFKMRFEG
EDSPERRYSGTVIGVKDCSPHWKDSKWRCLEVHWDEPASIPRPDKVSPWEIEPFVTSESV
PQSVMVKNKRPRQFSEVSALDVGITASNLWSSVLSQSHEFAQSCITSQRSPSQQCYRDST
EDAKKSDWLNNSYSVSNVSKESTLNDQMISPVEQKKPETTATYRLFGIDLMSPIEEKTAP
MRPINITTPTMDSNSDPKSGISKVPEEKKQEPAQTSPKEVQSKQNSSTRSRTKIYISTRP
WRSVIHEFQIKYTSVYDVCGIEHDPDSVIDEQVQMQGVPVGRAVDLAALNGYNELIEDLE
KLFDIKGELQSRNQWEVVFTDDEGDMMLVGDDPWPEFCNMVKRIFIWSKEEVKKMTPGNQ
LRMMLTEVETTFTTTSKTDNHSN
Download sequence
Identical sequences R0F8V9
Carubv10006513m|PACid:20894871 XP_006285168.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]