SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10006905m|PACid:20894516 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10006905m|PACid:20894516
Domain Number 1 Region: 8-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.77e-22
Family B3 DNA binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 145-240
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-19
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 3 Region: 270-371
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.82e-16
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10006905m|PACid:20894516
Sequence length 472
Sequence
MANALSRTKPHFFQPLIPGFENHLNIPVKFFSDHIVGKHDGRTVNLISDASERSWQVKMQ
GHRLTDGWKEFVEAHDLRIGDFLVFRHEGDMLFNVTALGPSCCEIQYSQSQPPSHEEGEE
SNETEVSSRSEKQVEENVKTECDQFSSDLNCFSLSVTASNLSRDTVCVPIHFAKRNGLNK
ERQEIVLMNEEGKSWASEVKSWGGCRLTIVRGWTSFCTANNLQVGDSRTFRLLPNTAETP
VFQLFSPTKSERRIQYAEGCIDGKTGEHRFVKLTPTPNSLHLGKQHLPASFTRENGLINP
GNIVLVDKNRAEWSMKLKADKATGLMYIISGNGWKSFCAANEIVVGESLILELIQGGVTP
LLKFSSKMEEPPFEAEAQAHKRARFQTWSQETEPNLKMREKTTEEGEASRASNKSSGNQE
NLHQKQPVPVSNQVAKVKDSVVDALTSIRRYMAELETTKQKLEISLKEINDL
Download sequence
Identical sequences R0F284
Carubv10006905m|PACid:20894516 XP_006282869.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]