SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10008159m|PACid:20891006 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10008159m|PACid:20891006
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-44
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 953-1017
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000118
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10008159m|PACid:20891006
Sequence length 1067
Sequence
MKAPSNGFLPNSNEGEKKPINSQLWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKQ
TDFIPNYPNLPSKLICLLHSVTLHADTETDEVYAQMTLQPVNKYDREALLASDMGLKLNR
QPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEIVAKDLHDTTWTFRH
IYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFVRDEKSQLMLGIRRANRQTPTLSSSVIS
SDSMHIGILAAAAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLGMRFRMMF
ETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQVGWDESTAGDRPSRVSIWEIEPVITP
FYICPPPFFRPKYPRQPGMPDDELDMENAFKRAMPWMGEEFGMKDAQSSMFPGLSLVQWM
SMQQNNPLSGSATPQLPSALSSYNLPNNFASNDPSKLLNFQSPNLSSANSQFNKLNTLNH
ISQQMQAQPAMVKSQQQQQQLQMSHQQLQQQGIYNTGSDVSAVANQVSCQNPHQSTTQSQ
LQQQSMLPNGVKMTHQNIHSGNKGSSQMTSFAQELQFQQQLELHNSSQSLRNQQEQSSLH
SLQQSLSQNPQQLQMQQQSPKPSPSQQLQLQLLQKLQQQQQQQSIPPVTSSLQPQFSALQ
QPQSHQLQQLLSSQNQQPLAHGNNSFSASTFMQPPQIQVNHQQQGQMNNKPLVAAGRSHS
GHTDGEAPSCSTSPSTNNTGHDNVSPTNFLSRNQQGQAVSVSASESVFERASNPVQELYA
KTDNRINQGMVNLKSAGEQFKFKGAVTDQIDVSTAGTTYCPDVVGSAQQQQTFPLPSFGF
DGDCQSHQPRNNLAFASNLEAVTSDALYSQKDFQNLVPNYGNAPRDIETELSSAAISSQS
FGIPSIPFKSGCSNEVGGINDSGIMNGGGLWPNQTQRMRTYTKVQKRGSVGRSIDVTRYS
GYDELRHDLARMFGIEGQLEDPLTSDWKLVYTDHENDILLVGDDPWEEFVNCVQNIKILS
SAEVQQMSLDGDLAAIPATNQACSETDSGNAWKVHYEDTSAAASFNR
Download sequence
Identical sequences R0IQP5
Carubv10008159m|PACid:20891006 XP_006306645.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]