SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10008165m|PACid:20891007 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10008165m|PACid:20891007
Domain Number 1 Region: 101-240
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-44
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 938-1002
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000118
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10008165m|PACid:20891007
Sequence length 1052
Sequence
MKAPSNGFLPNSNEGPLVSLPPVGSLVVYFPQGHSEQVAASMQKQTDFIPNYPNLPSKLI
CLLHSVTLHADTETDEVYAQMTLQPVNKYDREALLASDMGLKLNRQPTEFFCKTLTASDT
STHGGFSVPRRAAEKIFPPLDFSMQPPAQEIVAKDLHDTTWTFRHIYRGQPKRHLLTTGW
SVFVSTKRLFAGDSVLFVRDEKSQLMLGIRRANRQTPTLSSSVISSDSMHIGILAAAAHA
NANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLGMRFRMMFETEDCGVRRYMGTVT
GISDLDPVRWKGSQWRNLQVGWDESTAGDRPSRVSIWEIEPVITPFYICPPPFFRPKYPR
QPGMPDDELDMENAFKRAMPWMGEEFGMKDAQSSMFPGLSLVQWMSMQQNNPLSGSATPQ
LPSALSSYNLPNNFASNDPSKLLNFQSPNLSSANSQFNKLNTLNHISQQMQAQPAMVKSQ
QQQQQLQMSHQQLQQQGIYNTGSDVSAVANQVSCQNPHQSTTQSQLQQQSMLPNGVKMTH
QNIHSGNKGSSQMTSFAQELQFQQQLELHNSSQSLRNQQEQSSLHSLQQSLSQNPQQLQM
QQQSPKPSPSQQLQLQLLQKLQQQQQQQSIPPVTSSLQPQFSALQQPQSHQLQQLLSSQN
QQPLAHGNNSFSASTFMQPPQIQVNHQQQGQMNNKPLVAAGRSHSGHTDGEAPSCSTSPS
TNNTGHDNVSPTNFLSRNQQGQAVSVSASESVFERASNPVQELYAKTDNRINQGMVNLKS
AGEQFKFKGAVTDQIDVSTAGTTYCPDVVGSAQQQQTFPLPSFGFDGDCQSHQPRNNLAF
ASNLEAVTSDALYSQKDFQNLVPNYGNAPRDIETELSSAAISSQSFGIPSIPFKSGCSNE
VGGINDSGIMNGGGLWPNQTQRMRTYTKVQKRGSVGRSIDVTRYSGYDELRHDLARMFGI
EGQLEDPLTSDWKLVYTDHENDILLVGDDPWEEFVNCVQNIKILSSAEVQQMSLDGDLAA
IPATNQACSETDSGNAWKVHYEDTSAAASFNR
Download sequence
Identical sequences R0GUD5
XP_006306644.1.15642 Carubv10008165m|PACid:20891007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]