SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10008239m|PACid:20889064 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10008239m|PACid:20889064
Domain Number 1 Region: 114-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-48
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 778-862
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000216
Family PB1 domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10008239m|PACid:20889064
Sequence length 926
Sequence
MRLSSAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN
KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKDPYLPAELGV
PSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEWK
FRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPSS
VLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRF
RMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIEP
LTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMSMSMSSPLMWDRGLQSLNFQGMGVNP
WMQPRLDTSGLLGMQNDVYQAMAAAALQDMRGIDPAKAAASLLQFQNSSGFSMQSPSLVQ
PQMLQQQLSQQQQQLSQQQQQLSQQQQQQISQQQQQLSQQQQQQQQQAYLGVPETHQPQS
QAQSQSNNLLSQQQQQQVGDNHNPSASSPAVVSAMSQFGSASQSNTSPLQSMASLCHQQS
FSDTNGGNNPISPLHSLLSNFSQDESSQLLNLTRTNSAMTSSGWPSKRPAVDSSFQHSVP
GNNTQSVMEQLGQSHTSNVPPNAVSLPPFPGGRECSIEQEGSASDPHSHLLFGVNIDSSS
LLMPNGMSNLRSIGIEGGDSTTLPFTSSNLNNDFSGNLAMTTPSSCIDESGFLQSSENLG
SENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFV
DRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGKRGLELLNSAPSSNNVDKLPSNGN
CDDFGNRSDPRNLGNGIASVGGTFNY
Download sequence
Identical sequences R0GUI5
XP_006306714.1.15642 Carubv10008239m|PACid:20889064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]