SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10008258m|PACid:20888916 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10008258m|PACid:20888916
Domain Number 1 Region: 149-288
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-45
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 808-873
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000051
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10008258m|PACid:20888916
Sequence length 903
Sequence
MMASLACVDDKMKTNGLVNGGTTTTTTTTSQSSLLEEMKLLKDQSGTRKPVINSELWHAC
AGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLMCQVHNVTLHADK
DSDEIYAQMSLQPVHSERDVFPVPDFGLLSRSKHPAEFFCKTLTASDTSTHGGFSVPRRA
AEKLFPPLDYTAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAG
DSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLAAAAHATANRTPFLIFYN
PRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYMGTIVGISDLDPLRWP
GSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLTSGLKRQLHPSYFAGETEWG
SLIKRPLIRVPDSANGIMPYASFPNMASEQLMKMMMRPHNNQNVPSFMSEMQQNVIMGHG
GLLGDMKMQQPMMMNQKSEMVQPESKLTVNPSASNTSCQEQNLSQSMSAPAKPVNSTLSG
CSSGKAQNGLEQSIEQVSQVTTATVGNEEKVNQLIQKTGALSPIQADPCLDMSQQIYPPQ
SDPINGFSFLETEELTSQVSSFQSLAGSYKQPFMLSSQDSSAVVLPDSTNSPLFHDVWDN
QLNGLKFDQFSPLMQQDLYASQTMCMSNSTNSNILDPPLSNTVLDDFCAIKETDFQNHPS
SCLVGNNNSSFAQDVQSQITSASFADSQAFSRQDFPDNSGGTGTSSSNVDFDDSSLLQNS
KGSSWQKIATPRVRTYTKVQKTGSVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSS
GWKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAGINDLKT
SVT
Download sequence
Identical sequences R0GUJ7
Carubv10008258m|PACid:20888916 XP_006306729.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]