SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10009540m|PACid:20890696 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10009540m|PACid:20890696
Domain Number 1 Region: 52-144
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.11e-30
Family B3 DNA binding domain 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10009540m|PACid:20890696
Sequence length 359
Sequence
MDLSLAPTTTTSSDQEQDRDQELTSNIGASSSSGTGNNNNNLPMMMIPPAEKEHMFDKVV
TPSDVGKLNRLVIPKQHAERYFPLDSSNNQNGTLLNFQDRNGKMWRFRYSYWNSSQSYVM
TKGWSRFVKEKKLDAGDIVSFQRGIGDESERSKLYIDWRHRPDMSLVQAHQFGNFGFNFN
FPTTSQYSNRFQPLPEYNSVPIHRSLNLANHQRSYYNNNQRQEFVGYGYGNLAGRCYYTG
SPLDQRNIVGSEPLVIESVPVVPGRLTPVMLPPLPAPPSTAGKRLRLFGVNMECGNDYNQ
QEDSWLMPRREMGASSSSSSSALRLNLSTDHDDDDDDDGGDDDQFAKKGKSSFSLNFNP
Download sequence
Identical sequences R0GQN1
XP_006305173.1.15642 Carubv10009540m|PACid:20890696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]