SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10009612m|PACid:20889422 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10009612m|PACid:20889422
Domain Number 1 Region: 185-296
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-34
Family B3 DNA binding domain 0.00000113
Further Details:      
 
Domain Number 2 Region: 62-118
Classification Level Classification E-value
Superfamily DNA-binding domain 3.07e-17
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10009612m|PACid:20889422
Sequence length 347
Sequence
MEVSSVDESTTSTGSICETPAISPAKNSSSVGNNLYRMGSGSSVVLDSENGIEAESRKLP
SSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDVAVHRFRGRDAVTNFKDV
RMDDDEVEFLNSHSKSEIVDMLRKHTYNEELEQSKRRRNGSGNTVRTMLTSGLSNDGAST
TEFRSAEPLFEKAVTPSDVGKLNRLVIPKHHAEKHFPLPSTSVSVKGVLLNFEDVNGKVW
RFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVSFSRSNGQDQQLYIGWKSRSGSDLEP
GQVLRLFGVNISPASSRNDVVGNKRSVNDTEMLSLVCSKKQRIFHAS
Download sequence
Identical sequences R0GQT6
XP_006305243.1.15642 Carubv10009612m|PACid:20889422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]