SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10010224m|PACid:20890230 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10010224m|PACid:20890230
Domain Number 1 Region: 123-224
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-22
Family B3 DNA binding domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Carubv10010224m|PACid:20890230
Domain Number - Region: 19-66
Classification Level Classification E-value
Superfamily Rotavirus NSP2 fragment, C-terminal domain 0.0379
Family Rotavirus NSP2 fragment, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10010224m|PACid:20890230
Sequence length 227
Sequence
MDMNAAQNHFNKRARLFEDPNNRDARVMYPSNPTSAEQMNRGYGGSAAIQSFFKDSKPEE
TPPKVLKKRGRKKKNPNPEDINSSTPGGDDSENRSKFYESASARKRTVTAEERERAVNAA
KTFEPANPFFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKLQLGEKQWPVRCLYKA
GRAKFSQGWYEFTLENNIGEGDVCVFELLRTRDFILKVTAFRVNEYM
Download sequence
Identical sequences R0IJ37
Carubv10010224m|PACid:20890230 XP_006305572.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]