SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10011010m|PACid:20892221 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10011010m|PACid:20892221
Domain Number 1 Region: 120-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.98e-30
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 442-519
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000054
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10011010m|PACid:20892221
Sequence length 522
Sequence
MDGCNVANVQPDLSGTFYGSESYMYEQLWKLCAGPLCHLPNLGDKVYYFPQGHIELVEAA
TREELNQIQSNFDLPSKLECRVISVRLKAEKNTDQVYAEITLIPDARQVVIPTQNDSQYR
PKVNSFMKILTASDTSTHGGLSVPKRSATECLPPLDMDIPVPTQDILTKDLHDSVWKFKH
SFRGTPQRHLLTTGWSAFVTTKSLVAGDAFILLRGETGELRVGIRRARHQQGNITSSLVS
TENMRHGVIASALHAFNNQCMFTVVFKPRSSQFIVKYDKFLDAVNNKFNVGSRFTMRFEA
EDFSVKRYSGTIIGVDNFSPHWKDSEWRSLQVQWDELASFPRPEKVSPWEIEHIPPSSNI
PQSFLLKNKRSRHVNKIEVVQPSMNNEGGTSLRLFGVSLVVPSGKNESYQVSNTSKLCQK
KEFGLTQKFKLPKMAESKQFSSTRSCTKVQMQGVTVGRALDLSVLNGYDQLIHELEKLFD
LGGELQSRNQWEMVFIDHEGDHVLIGDVPWLEFCNMVKKILI
Download sequence
Identical sequences R0IK14
Carubv10011010m|PACid:20892221 XP_006304425.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]