SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10011321m|PACid:20892601 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10011321m|PACid:20892601
Domain Number 1 Region: 120-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-29
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 461-539
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000054
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10011321m|PACid:20892601
Sequence length 561
Sequence
MDGCNVANVQPDLSGTFYGSESYMYEQLWKLCAGPLCHLPNLGDKVYYFPQGHIELVEAA
TREELNQIQSNFDLPSKLECRVISVRLKAEKNTDQVYAEITLIPDARQVVIPTQNDSQYR
PKVNSFMKILTASDTSTHGGLSVPKRSATECLPPLDMGIPVPTQDILTKDLHDSVWKFKH
SFRGTPQRHLLTTGWSAFVTTKSLVVGDAFILLRGETGELRVGIRRARHQQGNITSSLVS
TENMRHGVIASALHAFNNQCMFTVFFKPRSSQFIVKYDKFLDAVNNKFNVGSRFTMRFEA
DDFSVKRYSGTIIGVNNFSPHWKDSEWRSLQVQWDEFASFPRPEKVSPWEIEHIPPSSNV
PQSFLLKNKRSRHVNKIGSSSSSSPHLLPPILTQNPEVVQPSMTNEGGTSLRLFGVSLVV
PSGKNESYQVSNTSKLCQEKEFGLTQTFKLPKMAESKQFSSTRSCTKVQMQGVTVGRALD
LSVLNGYDQLIYELEKLFDLGGELRSRNQWEMVFIDHEGDHVLIGDVPWLEFCNMVKKIL
ICSKEEVNKLKSERPISQTKS
Download sequence
Identical sequences R0IP37
Carubv10011321m|PACid:20892601 XP_006306025.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]