SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10011639m|PACid:20892821 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10011639m|PACid:20892821
Domain Number 1 Region: 98-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000589
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10011639m|PACid:20892821
Sequence length 215
Sequence
MSLGLHLPADKQNIPKTVEQIRQEILDRIFDHVPRRKRTCYEFLRKDTEQHLPSVPQEDK
DAILKRNIPKGRKTTSCEDKTPPEWLAQVMSRMKGAGDPKLIIEKTLDLNDVDPLLNRLS
IPISDVIQNDFLTLDESRMIDDDDITNQGNMGVAAYMKTSSGRSYWSFVLRGEWSNAVET
NGLKQGDNISLWSFRSSEILCFALVHLTSSFCVDK
Download sequence
Identical sequences R0IPH2
XP_006306145.1.15642 Carubv10011639m|PACid:20892821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]