SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10012044m|PACid:20888777 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10012044m|PACid:20888777
Domain Number 1 Region: 147-262
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000824
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10012044m|PACid:20888777
Sequence length 300
Sequence
MVIREEEEEASLLLFIWRHAIPTRLKRCVVEAIDREYRVFIRFPRKERTLRLHVSYSIES
FATEKEDPPKADSTLDVSYKESSSKPTRNIKRRPLSLPPRRQQPKKATRMANGRFKAGAS
LSENRETTPEWLVQLMREKNGQDPRNIINRGLTATDVASHFCRLCIPFHQIHDLQFLRPS
EERIIERRHGKKLCKGGVDSVLVGSDLKEFELNLVRWNVGDNPPYYLKGGWNRVVKEYQL
KKHDEIRLWSFHVGEELYFAMVPTSSTESGKSISGTGRMSSELVIKDQTSDGLPHTCLFL
Download sequence
Identical sequences R0IIH2
XP_006303785.1.15642 Carubv10012044m|PACid:20888777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]