SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10012060m|PACid:20890743 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10012060m|PACid:20890743
Domain Number 1 Region: 489-587
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-20
Family B3 DNA binding domain 0.0062
Further Details:      
 
Domain Number 2 Region: 9-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-19
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 3 Region: 146-247
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000451
Family B3 DNA binding domain 0.0088
Further Details:      
 
Domain Number 4 Region: 397-469
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000373
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 5 Region: 255-319
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000863
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10012060m|PACid:20890743
Sequence length 689
Sequence
MADQSLRSPTKPHFFKPLLPGFRTHLNIPVAFFSKHVEGRNDQNKTARLRSDASDETWLV
KMDGLKLTDGWEEFAFAHDLRIGDIVVFRHEGEMVFHVTALGPSCCEIKYTSPSSHNMIN
DDQTNIVSRNSSRVKKNTRKKVESSSNHSRFVANVTAWGLSNDRLNIPLTFARLNGLNKM
RGKKIYLHNEEGRSWKLGLVHDKAGMHTYFKSGWRSFCAANGISQGRYTFQLVRKSAPPV
IRLCRSNQRSAAESASDHSCFKRHVSPSSLRYDQLYLPRSFVSSNGWTNFCHVNGIKVGD
FFKFKLAGTWEEPVLSLCPAESNRDKTPLKCSEISNDVNPEESEEETTGDKNISRHYLDL
KKRKYRSRCRASVENMDDDQTNIVCERLIKLCDGILQYLPLTFERSNGLHKKSGERIVLL
DGEGRSWNLNLKYNEAGMHTYIRPGWTRFCDANGMSQGQQFTFKLVQKAAPPIMRLYLAK
RRPISESSSHHSYLVGSVTASSLTTDRLCLSRSFVRSSGLDKGYEEIVLENEWGKGWNLV
LKHYKSCCSTILGGGWTTFCQDNGLKPGDSFKFKLVGTGERPVLSLFLADSNHVSNHEKT
PLECPEGSDDVKYLSSSSGDDSSKSNESGNESIDGRNKNNSQYSGEIKKRKYFWKCRASS
PSYTQDRFVTLTLTQSAFQTYKLVSFINN
Download sequence
Identical sequences R0GPB9
Carubv10012060m|PACid:20890743 XP_006304728.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]