SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10012424m|PACid:20892847 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10012424m|PACid:20892847
Domain Number 1 Region: 120-240
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-29
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 429-501
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000196
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10012424m|PACid:20892847
Sequence length 520
Sequence
MDGCNVANVQPDLSGTFNGSESYMSEQLWKLCAGPLCHLPNLRDKVYYFPQGHIELVEAA
TREELNQIQSNFDLPSKLECRVISVRLKAEKNTDQVYAEITLIPDARQVVIPTQNDSQYR
PKVNSFMKILTASDTSTHGGLSVPKRSATECLPPLDMAIPVPTQDILTKDLHDSVWKFKH
SFRGTPQRHLLTTGWSAFITTKSLVAGDAFILLRGETGELRVGIRRARHQQGNITSPLVS
TENMRHGVIASALHAFHNQCMFTVVFKPRSSQFIVNYDKFLDAVNNKFNVGSRFTMRFEA
EDFSEKRYSGTIIGVGNFSPHWKDSEWRSLQVQWDELASFPRPEKVSPWEIEHIPSSSNV
PQSSLLIKNKRSRHVNEIGSSSFSPHLLPPILTQNPEVVQPSMANEGGTSFRLFGVSLVV
PFGKNESYQVQMQGVTVGRALDLSVLNGYDQLIHELEKLFDLPGELRSRNQWEMVFTDHE
GDVVLMGDVPWLEFCNMVKKILICSKEEVNKLKSETNLPN
Download sequence
Identical sequences R0IH47
Carubv10012424m|PACid:20892847 XP_006304807.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]