SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10012748m|PACid:20904326 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10012748m|PACid:20904326
Domain Number 1 Region: 175-285
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.03e-30
Family EF-G/eEF-2 domains III and V 0.0000264
Further Details:      
 
Domain Number 2 Region: 1-94
Classification Level Classification E-value
Superfamily Translation proteins 1.15e-26
Family Elongation factors 0.0000701
Further Details:      
 
Domain Number 3 Region: 102-154
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000612
Family EF-G/eEF-2 domains III and V 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10012748m|PACid:20904326
Sequence length 291
Sequence
MIPASDKGRFFAFGRVFAGKVSTGMKVRIMGPNFVPGEKKDLFVKSVQRTVIWMGKRQET
VEDVPCGNTVAMVGLDQFITKNATLTNESEVDAHPIRAMKFSVSPVVRVAVQCKVASDLP
KLVEGLKRLSKSDPMVVCSMEESGQHIVAGGGQVIPTARRVIYASQITAKPRLLEPVYMV
EIQAPEGALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSAQLRAATSGQ
AFPQSVFDHWDMMASDPLELGTQASTLVAEIRKRKGLKEQMTPLSDFEDKL
Download sequence
Identical sequences Carubv10012748m|PACid:20904326 Carubv10012749m|PACid:20904327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]