SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10014420m|PACid:20899097 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10014420m|PACid:20899097
Domain Number 1 Region: 118-216
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-24
Family B3 DNA binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10014420m|PACid:20899097
Sequence length 262
Sequence
MVESELSYEQIRLKRVEENKKRMGELNLNKLAQSLRVSSSPKPSPSKTRTMRMPVDFSEV
RRSSRAKGPPPSYKEFGLEPLERPRRSYQRRDLLNRVYASDEARVYAVDRAEKLQSSLDP
EFPSFVKPMLQSHVTGGFWLGLPLRFCKTHLPKRDEWMTLVDEEDEEFVAKYLVEKNGLS
GGWRGFSIDHQLVDGDAVVFHLITPTTFKVYIIRVNDDGNNDSDVNEEDEEDDIDINKKE
KEHVSEARQLRSSGKRKRGGRK
Download sequence
Identical sequences R0I040
Carubv10014420m|PACid:20899097 XP_006298352.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]