SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10015086m|PACid:20900340 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10015086m|PACid:20900340
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.87e-19
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 224-314
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-16
Family B3 DNA binding domain 0.032
Further Details:      
 
Domain Number 3 Region: 137-222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000194
Family B3 DNA binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10015086m|PACid:20900340
Sequence length 326
Sequence
MPSSPVNPHFFRPLLPGFHTHLNIPMAFFLRHIQGTTNEGNGVVKLRSFVSDITWQVKMD
GRRLTQGWQKFATSHDLRVGDIVVFRHDGDLLFHVTCFGPSCCEFQYDDDDVIQLSSDYS
DSERNQNTAEAKSSSDDPHSCFVACVTESNLRKDILGEIILLNEHGIPWTLILSHKPDGE
VYIRSGWRSFCITNRLRANDFLTLKLVQTGTTPVLQLCPSSTASQYRFLTLTLKPYNFKK
YKLCLPRTFVKTNGIEKARKITLVNRYGIKRTTSLKPEDGYGRMRLGKEWREFCDVNGVN
IGDSFELELIKEGEDTGSHLLKFCSK
Download sequence
Identical sequences R0HQ08
Carubv10015086m|PACid:20900340 XP_006298961.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]