SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10015496m|PACid:20899404 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10015496m|PACid:20899404
Domain Number 1 Region: 15-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-20
Family B3 DNA binding domain 0.0025
Further Details:      
 
Domain Number 2 Region: 208-302
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000569
Family B3 DNA binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10015496m|PACid:20899404
Sequence length 303
Sequence
MARNGDYLRCLQERKHEGFFKAVQSIDVASENMRALPHDFVRSFSDKELSCKMKIRTQWG
RSWEVEISKNPRFYFMEKSGWDKFVKDNALGHSEFLTFTHNGNMCFTVNIFKQNGKEMLQ
PSHSRAFLASSSRVKTEQRRGSVYNDFKKEEVLSPELSNRSPTTVVESNGGESYKRKLSF
GKKKAEETQNSKRTEKVVRARRDSAGASSSSVSEFTILFKKANQIFQRIPVSFAKDHMPE
EKTMFKIHHQDGKKSWNVIYLMKFRSFSGGWRSVVKEYPLDPGDTCKFTLIEPNELLLVV
FKP
Download sequence
Identical sequences R0G9A5
XP_006299339.1.15642 Carubv10015496m|PACid:20899404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]