SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10015809m|PACid:20898079 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10015809m|PACid:20898079
Domain Number 1 Region: 24-122
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.61e-24
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10015809m|PACid:20898079
Sequence length 207
Sequence
MVTTRKTMARDTFSSHRRQPQDPESPVKKFFKLVLPSTMENNMMRIPPKFVKLQGSKFPD
VVTLETPVGFKRSIKLKRIGQEIWFHEGWSEFAEAHSIKEGHFLSFEYDENSSFHVIIFN
VSASEIDYPPDALQISDSDDDIVDITDKGFIGTQGTRNNDQSVNGEHKLKKRPRDIELDK
ILHKVDVLDSNQVLKEEEEDDKRVFRG
Download sequence
Identical sequences R0GA33
Carubv10015809m|PACid:20898079 XP_006299629.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]