SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10016124m|PACid:20897752 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10016124m|PACid:20897752
Domain Number 1 Region: 13-47
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000151
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 128-206
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000051
Family B3 DNA binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10016124m|PACid:20897752
Sequence length 209
Sequence
CELCFVASLDEYGWEKFVKDNALGHSEFLTFTHKGNMCFTVNIFKQNGKEMLQPSQSRAS
FASSSSIKIEPEEEVMVSSSELSNRGATTAAESNGRKLKFGKKLAEESQNSKKAEKLVCA
ERGSAGASSSTPVKFTIIMKNSDFLEFLPIPRSVSKYYYMPKEKAMLKIHHPDGKRSWIL
CKEYPLAVGHTCKFTLIKPNELLLVVSKD
Download sequence
Identical sequences R0I8G9
Carubv10016124m|PACid:20897752 XP_006299915.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]