SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10016176m|PACid:20899217 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10016176m|PACid:20899217
Domain Number 1 Region: 91-197
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000137
Family B3 DNA binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10016176m|PACid:20899217
Sequence length 207
Sequence
MNTEDYDNPSLSPTRPRLLDLFPSQSVALDLFPCRSVVLDLFPCQSGDFARVVPSAARNE
RRVVSLAHFRNMPREERDNVSTELTLSIEGDIWKIKKTLSKSDVGIQTRLLIPKESANEH
ILKYLTEEEIKLVEDEGNRGLKITLFDTANKSTNQLCLKRWNSAGSYVLKSNWNKDFVEE
KGLEAGKQIELFWNPYASRLHFRVLKN
Download sequence
Identical sequences R0I8N3
XP_006299965.1.15642 Carubv10016176m|PACid:20899217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]