SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10016530m|PACid:20893346 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10016530m|PACid:20893346
Domain Number 1 Region: 201-315
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000102
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10016530m|PACid:20893346
Sequence length 317
Sequence
MTSFFNDLEMLAHISCEISERDRLLTEKAKSKCSKSDSDQEESKNIVFPKETRSSLVEKH
VTRDTSKTRNRPRKYEDQQRTDKSRSMTVSEDSEDHLPQKRRSSLDNFFRRTYTHLTVST
SPLFLNTDESDNTVSKCCINPNSQSSSCLMENRKRKKRAVPESVRSKKAKVASFPRQDRE
TPKWLFEVMREMEGAEGPIRLIYEKILTASDVKSSESRLLIPFKKLLRNDFLTPAESQAV
GNVGVETILVNQWFKEWSLRCKIWVMKKKGSGKRTLNYALNGGWNAVVKGNELKAKDKIS
LWTFRCRGVLCFALDTK
Download sequence
Identical sequences R0GI11
Carubv10016530m|PACid:20893346 XP_006279047.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]