SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10017696m|PACid:20886408 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10017696m|PACid:20886408
Domain Number 1 Region: 22-133
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-32
Family B3 DNA binding domain 0.00000948
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10017696m|PACid:20886408
Sequence length 308
Sequence
MNIQEEEKPINEEASNSSMEREHMFDKVVTPSDVGKLNRLVIPKQHAERHFPLDNSTSND
SNKGLLLNFEDRSGNSWRFRYSYWNSSQSYVMTKGWSRFVKDKKLDAGDIVSFQRDSGNK
DKLYIDWRRRPKIPDHHHHHQASHHPFAGAIFPRFYTYSQYPQMPTNYESHNLYHRFHQR
DLGIGYYVRSMERSHPTAVIESVPVMMQRRAQVASRGEKRLRLFGVDMECGSGGGGGSVN
NSTEEESSSSGGSMPRGGVSMVGAGSLLQLRLVSSDDESLVAMEAASLEDHHFFTKKGKS
SLSFDLET
Download sequence
Identical sequences R0H589
XP_006291541.1.15642 Carubv10017696m|PACid:20886408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]