SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10018524m|PACid:20886356 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10018524m|PACid:20886356
Domain Number 1 Region: 2182-2433
Classification Level Classification E-value
Superfamily BEACH domain 8.37e-89
Family BEACH domain 0.000000126
Further Details:      
 
Domain Number 2 Region: 2548-2616,2650-2769,2798-2845
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.24e-28
Family WD40-repeat 0.011
Further Details:      
 
Domain Number 3 Region: 2061-2170
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-22
Family PreBEACH PH-like domain 0.0018
Further Details:      
 
Domain Number 4 Region: 393-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000317
Family Clostridium neurotoxins, the second last domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10018524m|PACid:20886356
Sequence length 2901
Sequence
MEEDKVNNLSKASVGHLDVADDKPSVVDNSGFLADEHALVGMDDADHLQGISSVDAVLKD
DHFDQVSLGDQDKHLNQSLSATSLDSFYHQESGYPMVQSPQKPKPKATMPNVSPELLHLV
DSAIMGKPESLDKLKNIVSGDESFGSGGDSETIAFLVIDSLLATMGGVESFEEDEDSNPP
SVMLNSRAAIVAGELIPCLPCSGDSVNFMSPRTRMVRGLLAILRSCTRNRAMCSMAGLLS
VLLRSVEEIISKDATMMWNAAVLFHCIQHLAGHSLSVDDLYRWLHVIKNSLPTVWSSPLM
DALEKAMNGKESRGPACSFQFVGESSGLLGPGESRWPFTNGYAFATWIYIESFADTLDAS
TAAAAIAAASAAKSGKTSSAAATNVHTGEGTAHMPRLFSFLTPDNQGIEAYFYAQFLVVE
SGSGKGSKTSLHFTHAFKPQRWYFIGLEHTCNQGLLGNSDSELRLYIDGSLYETHPFEYP
RISKPLSFCCIGSNPPSTAAGLQRRRRQCALFAEIGPVYIFKEPIGPEIMTRLATRGGDA
LPCFGDGAGIPWLATNDRVRNEAEENSFLDLELGVYIHLLYHPFLLSGRFCPDASLSGAA
GTQRRPAEVIGQVHVATRVKSVESFWALAYGGPMSLLPLTVSSVHKDSLEPFSRNLPSSL
TTYSLAAPIFRIISVAIQHPGNNEELSRSRGPEILATVLGYLLHSLASLDRKHDRVGDEE
LVSAIVSLCQSQKINHAFKVQLFRTLLLDLKIWSVCNYRLQKKLLSSLQDMVFTEATAMR
NADAIQILLGGCRRYYWTIQEKDSVNTFSLDGDERQVGEVNALVDELLVIIELLMGAASP
SFAAADVHLLLGFIIDSPQPNQVARVLHLMFRLVVQPNAAKAQTFAEAFITSGGIETLLV
LLQREAKSGEEDVTYSVAKGQTSVPTNHSDQSQHDGRGLLKHFDSVPQGNEDESHAHDDN
EGSFKETESVKQEKAHGSATAICDSDSVTISNSMNADRVSSFSETPFNNNARNNVDDKDR
VMIGIIRLIGALISKGHLKFSIGAESDVMSNLMGSGLHENGGTMFDDKVSLLLFALLKAF
QVAPNRLMTDNVYTTLLGASINASSTEDSLNFYDSGRRFEHPQLLLILLRSLPFASKALQ
NRALQDLLFLACSHPENRSSLTKMEEWPEWILEILISNYEKDAGKQSASHGSAEVEDLIH
NFLIIMLEHSMRQKDGWKEIEATIHCAEWLSIVGGSSTGEKRIRREESLPIFKRRLLGGL
LDFTSRELQAQTQVIAAASAGFAAESLTPKDAKAGVENAAQLSVFLVENTIVILMLVEDH
LRIQSKQNCAASAVDVSPSPLSLVYPLNNRSRTLPTVGESSEVSSSRASVSSDSGGVHLD
ILASMADASGQISTAVMERLAAAAAAEPYESVSCAFVSYGSCAMDLAEGWKYRSRLWYGV
GLPSKTSCFGGGGSGWDSWKHALQKDSHGNWIELPLVKKSVSMLQALLLDESGLGGGLGI
GGGSGTGMGGMAALYQLLDSDQPFLCMLRMVLLSLREEDHGEDSLLMKNLSSEDGFSGGL
QCPLGNSASLDISSQMSMRQSPSALLWSVLSPVLNMPITDSKRQRVLVTTCVLYSEVWNA
VSKDRKPLRKQYLEAILPPFVAILRRWRPLLAGIHELATGDGFNPLVADDRALAADALPI
EAAISMISPEWAAAFASPPSAMALAMIAAGAAGWEAPAPPATPAPPPLRRDSSLLERKST
KLQTFSSFQKPLEAPNDDSPGRPRDKAAAKAAALAAARDLERNAKIGSGRGLSAVAMATS
AQRRTISDMERLQRWNISEAMGVAWIECLQPVDTKSVYGKDFNALSYKFIAVLVASFAFA
RNMQRSEVFSLALSHFVFFLSEIDRRMQNDKIVKNRLCMGISGWRKFVRYLVEMRCFFGP
FGEQFCSPKHVFWKLDSMESSSRMRQCLRRNYSGTSHLETTRNYEDKADLKNNQDNLDSL
SNAPVLAVEAISTEIMCEDDEHEDADDLEIESNVVEHKGENEERRSGTLEDAITLSTGMN
DHRPLSEHDMVQNSTEVVLNERIVLEITSSMVRPLGVVKGTFQITTRRINFIVDTGEDQH
LDEKSDGSKSKDQERDRSWLMSSLHQIYSRRYLLRKSALELFMVDRSNFFFDFGNTEGRR
NACRAIVQARPPLLKDIYLATQRPEQLLGRTQLMQRWARREISNFEYLMHLNTLAGRSYN
DISQPIGTLNPERLKKFQEQFSSYEDPVIPKFHYDSHYSSVGVVLHYLARVEPFTTLSIQ
RGGNFSRANHMFSDIAATWKGVLQEMSNVKELVPELFYLPEVLTNENLVEKLDSVKLPPW
AKSPIDFVHKQRMALESEHVSAHLHEWIDLIFGYKQRGKEATLASNVFFYTTYEGTVDID
KITDPVQQRNIQDQIVNIGQTPLQLLTVPHIKRMPLKDALHMQTIFRNPKGIRPYPVPAP
EHCNLPAAAIKASLDTVVIVDMNVPASHIAQHKWQPNTPVGQNAPFIFHHGKPSSAGGTL
IRMFKSDWEYPQAQAFASSGIRSSSVTAITNDGEIITGGHVDNSIKIVSSDGAKTLETAF
GHCAPVTYLSLSTDNNFLVTGSRDTTVLLWRFHKRFTSQTSDSEQTTSSVTPSSASSNNL
ANKAKKGRIEGPIQVLRGHRREICCCCVSSDQGIVVSCSESSDVLLHSIRNGRLIRRFVG
VEAHALCISSDGVIVVWSSSEISISTFTINGVLISKARLPSSCTISCMELSMDGQNVVIG
VNSFSDIDGSRSFNNITGEDDSSNISKEVERLYIPSPSVCFLNLYTLQVFHVLKLGEGQD
ITAMALNTDNTNLLVSTEDKQLIIFTDPAICRKKLAAPTEDLQREVGWLMMEKKKKKLNN
DIDGAFCKILNSQNQLRLLVS
Download sequence
Identical sequences R0FS50
XP_006292313.1.15642 Carubv10018524m|PACid:20886356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]